PLAUR monoclonal antibody (M01), clone 2F11
  • PLAUR monoclonal antibody (M01), clone 2F11

PLAUR monoclonal antibody (M01), clone 2F11

Ref: AB-H00005329-M01
PLAUR monoclonal antibody (M01), clone 2F11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PLAUR.
Información adicional
Size 100 ug
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq CMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEEPELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PLAUR (NP_002650, 25 a.a. ~ 134 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.2
Gene ID 5329
Clone Number 2F11
Iso type IgG1 Kappa

Enviar un mensaje


PLAUR monoclonal antibody (M01), clone 2F11

PLAUR monoclonal antibody (M01), clone 2F11