PLAUR purified MaxPab rabbit polyclonal antibody (D01P)
  • PLAUR purified MaxPab rabbit polyclonal antibody (D01P)

PLAUR purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005329-D01P
PLAUR purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PLAUR protein.
Información adicional
Size 100 ug
Gene Name PLAUR
Gene Alias CD87|UPAR|URKR
Gene Description plasminogen activator, urokinase receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGHPPLLPLLLLLHTCVPASWGLRCMQCKTNGDCRVEECALGQDLCRTTIVRLWEEGEELELVEKSCTHSEKTNRTLSYRTGLKITSLTEVVCGLDLCNQGNSGRAVTYSRSRYLECISCGSSDMSCERGRHQSLQCRSPEEQCLDVVTHWIQEGEEGRPKDDRHLRGCGYLPGCPGSNGFHNNDTFHFLKCCNTTKCNEGPILELENLPQNGRQCYSCKGNSTHGCSSEETFLIDCRGPMNQCLVATGTHEPKN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PLAUR (NP_002650.1, 1 a.a. ~ 335 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.2
Gene ID 5329

Enviar un mensaje


PLAUR purified MaxPab rabbit polyclonal antibody (D01P)

PLAUR purified MaxPab rabbit polyclonal antibody (D01P)