PKNOX1 polyclonal antibody (A01)
  • PKNOX1 polyclonal antibody (A01)

PKNOX1 polyclonal antibody (A01)

Ref: AB-H00005316-A01
PKNOX1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PKNOX1.
Información adicional
Size 50 uL
Gene Name PKNOX1
Gene Alias PREP1|pkonx1c
Gene Description PBX/knotted 1 homeobox 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq MATQTLSIDSYQDGQQMQVVTELKTEQDPNCSEPDAEGVSPPPVESQTPMDVDKQAIYRHPLFPLLALLFEKCEQSTQGSEGTTSASFDVDIENFVRKQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKNOX1 (NP_004562, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5316

Enviar un mensaje


PKNOX1 polyclonal antibody (A01)

PKNOX1 polyclonal antibody (A01)