PKD2 monoclonal antibody (M02), clone 1G3
  • PKD2 monoclonal antibody (M02), clone 1G3

PKD2 monoclonal antibody (M02), clone 1G3

Ref: AB-H00005311-M02
PKD2 monoclonal antibody (M02), clone 1G3

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PKD2.
Información adicional
Size 100 ug
Gene Name PKD2
Gene Alias APKD2|MGC138466|MGC138468|PC2|PKD4
Gene Description polycystic kidney disease 2 (autosomal dominant)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq PVSKTEKTNFKTLSSMEDFWKFTEGSLLDGLYWKMQPSNQTEADNRSFIFYENLLLGVPRIRQLRVRNGSCSIPQDLRDEIKECYDVYSVSSEDRAPFGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PKD2 (NP_000288, 261 a.a. ~ 360 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5311
Clone Number 1G3
Iso type IgG2b Kappa

Enviar un mensaje


PKD2 monoclonal antibody (M02), clone 1G3

PKD2 monoclonal antibody (M02), clone 1G3