PITX2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PITX2 purified MaxPab rabbit polyclonal antibody (D01P)

PITX2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005308-D01P
PITX2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PITX2 protein.
Información adicional
Size 100 ug
Gene Name PITX2
Gene Alias ARP1|Brx1|IDG2|IGDS|IGDS2|IHG2|IRID2|MGC111022|MGC20144|Otlx2|PTX2|RGS|RIEG|RIEG1|RS
Gene Description paired-like homeodomain 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq METNCRKLVSACVQLEKDKSQQGKNEDVGAEDPSKKKRQRRQRTHFTSQQLQELEATFQRNRYPDMSTREEIAVWTNLTEARVRVWFKNRRAKWRKRERNQQAELCKNGFGPQFNGLMQPYDDMYPGYSYNNWAAKGLTSASLSTKSFPFFNSMNVNPLSSQSMFSPPNSISSMSMSSSMVPSAVTGVPGSSLNSLNNLNNLSSPSLNSAVPTPACPYAPPTPPYVYRDTCNSSLASLRLKAKQHSSFGYASVQN
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PITX2 (NP_700476.1, 1 a.a. ~ 271 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5308

Enviar un mensaje


PITX2 purified MaxPab rabbit polyclonal antibody (D01P)

PITX2 purified MaxPab rabbit polyclonal antibody (D01P)