PITX1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PITX1 purified MaxPab rabbit polyclonal antibody (D01P)

PITX1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005307-D01P
PITX1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PITX1 protein.
Información adicional
Size 100 ug
Gene Name PITX1
Gene Alias BFT|POTX|PTX1
Gene Description paired-like homeodomain 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IF
Immunogen Prot. Seq MDAFKGGMSLERLPEGLRPPPPPPHDMGPAFHLARPADPREPLENSASESSDTELPEKERGGEPKGPEDSGAGGTGCGGADDPAKKKKQRRQRTHFTSQQLQELEATFQRNRYPDMSMREEIAVWTNLTEPRVRVWFKNRRAKWRKRERNQQLDLCKGGYVPQFSGLVQPYEDVYAAGYSYNNWAAKSLAPAPLSTKSFTFFNSMSPLSSQSMFSAPSSISSMTMPSSMGPGAVPGMPNSGLNNINNLTGSSLNS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PITX1 (NP_002644.3, 1 a.a. ~ 314 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5307

Enviar un mensaje


PITX1 purified MaxPab rabbit polyclonal antibody (D01P)

PITX1 purified MaxPab rabbit polyclonal antibody (D01P)