PIK3CD polyclonal antibody (A01)
  • PIK3CD polyclonal antibody (A01)

PIK3CD polyclonal antibody (A01)

Ref: AB-H00005293-A01
PIK3CD polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIK3CD.
Información adicional
Size 50 uL
Gene Name PIK3CD
Gene Alias p110D
Gene Description phosphoinositide-3-kinase, catalytic, delta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DFRAKMCQFCEEAAARRQQLGWEAWLQYSFPLQLEPSAQTWGPGTLRLPNRALLVNVKFEGSEESFTFQVSTKDVPLALMACALRKKATVFRQPLVEQPEDYTLQVNGRH
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3CD (NP_005017, 138 a.a. ~ 247 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5293

Enviar un mensaje


PIK3CD polyclonal antibody (A01)

PIK3CD polyclonal antibody (A01)