PIM1 monoclonal antibody (M09), clone 1B8
  • PIM1 monoclonal antibody (M09), clone 1B8

PIM1 monoclonal antibody (M09), clone 1B8

Ref: AB-H00005292-M09
PIM1 monoclonal antibody (M09), clone 1B8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIM1.
Información adicional
Size 100 ug
Gene Name PIM1
Gene Alias PIM
Gene Description pim-1 oncogene
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MLLSKINSLAHLRAAPCNDLHATKLAPGKEKEPLESQYQVGPLLGSGGFGSVYSGIRVSDNLPVAIKHVEKDRISDWGELPNGTRVPMEVVLLKKVSSGF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIM1 (AAH20224.1, 1 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5292
Clone Number 1B8
Iso type IgG1 Kappa

Enviar un mensaje


PIM1 monoclonal antibody (M09), clone 1B8

PIM1 monoclonal antibody (M09), clone 1B8