PIK3CA polyclonal antibody (A01)
  • PIK3CA polyclonal antibody (A01)

PIK3CA polyclonal antibody (A01)

Ref: AB-H00005290-A01
PIK3CA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PIK3CA.
Información adicional
Size 50 uL
Gene Name PIK3CA
Gene Alias MGC142161|MGC142163|PI3K|p110-alpha
Gene Description phosphoinositide-3-kinase, catalytic, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key ELISA
Immunogen Prot. Seq DFLIVISKGAQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIAYIRKTLALDKTEQEALEYFMKQMNDAHHGGWTTKMDWIFHTIKQHALN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3CA (NP_006209, 959 a.a. ~ 1068 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5290

Enviar un mensaje


PIK3CA polyclonal antibody (A01)

PIK3CA polyclonal antibody (A01)