PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)
  • PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)

PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005289-B01P
PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PIK3C3 protein.
Información adicional
Size 50 ug
Gene Name PIK3C3
Gene Alias MGC61518|Vps34
Gene Description phosphoinositide-3-kinase, class 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MGEAEKFHYIYSCDLDINVQLKIGSLEGKREQKSYKAVLEDPMLKFSGLYQETCSDLYVTCQVFAEGKPLALPVRTSYKAFSTRWNWNEWLKLPVKYPDLPRNAQVALTIWDVYGPGKAVPVGGTTVSLFGKYGMFRQGMHDLKVWPNVEADGSEPTKTPGRTSSTLSEDQMSRLAKLTKAHRQGHMVKVDWLDRLTFREIEMINESEKRSSNFMYLMVEFRCVKCDDKEYGIVYYEKDGDESSPILTSFELVKV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PIK3C3 (NP_002638.2, 1 a.a. ~ 887 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5289

Enviar un mensaje


PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)

PIK3C3 purified MaxPab mouse polyclonal antibody (B01P)