PIK3C2G monoclonal antibody (M01), clone 3D8
  • PIK3C2G monoclonal antibody (M01), clone 3D8

PIK3C2G monoclonal antibody (M01), clone 3D8

Ref: AB-H00005288-M01
PIK3C2G monoclonal antibody (M01), clone 3D8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK3C2G.
Información adicional
Size 100 ug
Gene Name PIK3C2G
Gene Alias MGC163149|PI3K-C2GAMMA
Gene Description phosphoinositide-3-kinase, class 2, gamma polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AYSWQTDPNPNESHEKQYEHQEFLFVNQPHSSSQVSLGFDQIVDEISGKIPHYESEIDENTFFVPTAPKWDSTGHSLNEAHQISLNEFTSKSRELSWHQ
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3C2G (NP_004561, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5288
Clone Number 3D8
Iso type IgG1 Kappa

Enviar un mensaje


PIK3C2G monoclonal antibody (M01), clone 3D8

PIK3C2G monoclonal antibody (M01), clone 3D8