PIK3C2A monoclonal antibody (M05), clone 3E7
  • PIK3C2A monoclonal antibody (M05), clone 3E7

PIK3C2A monoclonal antibody (M05), clone 3E7

Ref: AB-H00005286-M05
PIK3C2A monoclonal antibody (M05), clone 3E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIK3C2A.
Información adicional
Size 100 ug
Gene Name PIK3C2A
Gene Alias CPK|DKFZp686L193|MGC142218|PI3-K-C2(ALPHA)|PI3-K-C2A
Gene Description phosphoinositide-3-kinase, class 2, alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MVMHIKDLVTEDGADPNPYVKTYLLPDNHKTSKRKTKISRKTRNPTFNEMLVYSGYSKETLRQRELQLSVLSAESLRENFFLGGVTLPLKDFNLSKETVKWYQLTAATYL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIK3C2A (NP_002636, 1577 a.a. ~ 1686 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5286
Clone Number 3E7
Iso type IgG1 Kappa

Enviar un mensaje


PIK3C2A monoclonal antibody (M05), clone 3E7

PIK3C2A monoclonal antibody (M05), clone 3E7