PIGH monoclonal antibody (M01), clone 2F8
  • PIGH monoclonal antibody (M01), clone 2F8

PIGH monoclonal antibody (M01), clone 2F8

Ref: AB-H00005283-M01
PIGH monoclonal antibody (M01), clone 2F8

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PIGH.
Información adicional
Size 100 ug
Gene Name PIGH
Gene Alias GPI-H
Gene Description phosphatidylinositol glycan anchor biosynthesis, class H
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq TLLIIDSLGIQMTSSYASGKESTTFIEMGKVKDIVINEAIYMQKVIYYLCILLKDPVEPHGISQVVPVFQSAKPRLDCLIEVYRSCQEILAHQKATSTSP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PIGH (NP_004560, 89 a.a. ~ 188 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5283
Clone Number 2F8
Iso type IgG2a Kappa

Enviar un mensaje


PIGH monoclonal antibody (M01), clone 2F8

PIGH monoclonal antibody (M01), clone 2F8