SERPINB9 monoclonal antibody (M06), clone 1F5
  • SERPINB9 monoclonal antibody (M06), clone 1F5

SERPINB9 monoclonal antibody (M06), clone 1F5

Ref: AB-H00005272-M06
SERPINB9 monoclonal antibody (M06), clone 1F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SERPINB9.
Información adicional
Size 100 ug
Gene Name SERPINB9
Gene Alias CAP-3|CAP3|PI9
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IHC-P,S-ELISA,ELISA
Immunogen Prot. Seq DMESVLRHLGIVDAFQQGKADLSAMSAERDLCLSKFVHKSFVEVNEEGTEAAAASSCFVVAECCMESGPRFCADHPFLFFIRHNRANSILFCGRFSS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINB9 (NP_004146, 279 a.a. ~ 375 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5272
Clone Number 1F5
Iso type IgG2a Kappa

Enviar un mensaje


SERPINB9 monoclonal antibody (M06), clone 1F5

SERPINB9 monoclonal antibody (M06), clone 1F5