SERPINB9 MaxPab mouse polyclonal antibody (B01P)
  • SERPINB9 MaxPab mouse polyclonal antibody (B01P)

SERPINB9 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005272-B01P
SERPINB9 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINB9 protein.
Información adicional
Size 50 ug
Gene Name SERPINB9
Gene Alias CAP-3|CAP3|PI9
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 9
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq METLSNASGTFAIRLLKILCQDNPSHNVFCSPVSISSALAMVLLGAKGNTATQMAQALSLNTEEDIHRAFQSLLTEVNKAGTQYLLRTANRLFGEKTCQFLSTFKESCLQFYHAELKELSFIRAAEESRKHINTWVSKKTEGKIEELLPGSSIDAETRLVLVNAIYFKGKWNEPFDETYTREMPFKINQEEQRPVQMMYQEATFKLAHVGEVRAQLLELPYARKELSLLVLLPDDGVELSTVEKSLTFEKLTAWT
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINB9 (NP_004146.1, 1 a.a. ~ 376 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5272

Enviar un mensaje


SERPINB9 MaxPab mouse polyclonal antibody (B01P)

SERPINB9 MaxPab mouse polyclonal antibody (B01P)