SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)
  • SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005271-D01P
SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SERPINB8 protein.
Información adicional
Size 100 ug
Gene Name SERPINB8
Gene Alias CAP2|PI8
Gene Description serpin peptidase inhibitor, clade B (ovalbumin), member 8
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MDDLCEANGTFAISLFKILGEEDNSRNVFFSPMSISSALAMVFMGAKGSTAAQMSQALCLYKDGDIHRGFQSLLSEVNRTGTQYLLRTANRLFGEKTCDFLPDFKEYCQKFYQAELEELSFAEDTEECRKHINDWVAEKTEGKISEVLDAGTVDPLTKLVLVNAIYFKGKWNEQFDRKYTRGMLFKTNEEKKTVQMMFKEAKFKMGYADEVHTQVLELPYVEEELSMVILLPDDNTDLAVKE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINB8 (NP_001027018.1, 1 a.a. ~ 242 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5271

Enviar un mensaje


SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINB8 purified MaxPab rabbit polyclonal antibody (D01P)