SERPINE2 monoclonal antibody (M01), clone 3G12
  • SERPINE2 monoclonal antibody (M01), clone 3G12

SERPINE2 monoclonal antibody (M01), clone 3G12

Ref: AB-H00005270-M01
SERPINE2 monoclonal antibody (M01), clone 3G12

Información del producto

Mouse monoclonal antibody raised against a partial recombinant SERPINE2.
Información adicional
Size 100 ug
Gene Name SERPINE2
Gene Alias GDN|PI7|PN1|PNI
Gene Description serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,WB-Re,ELISA
Immunogen Prot. Seq RTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPD
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen SERPINE2 (NP_006207, 72 a.a. ~ 172 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5270
Clone Number 3G12
Iso type IgG2a Kappa

Enviar un mensaje


SERPINE2 monoclonal antibody (M01), clone 3G12

SERPINE2 monoclonal antibody (M01), clone 3G12