SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)
  • SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)

SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005270-B01P
SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINE2 protein.
Información adicional
Size 50 ug
Gene Name SERPINE2
Gene Alias GDN|PI7|PN1|PNI
Gene Description serpin peptidase inhibitor, clade E (nexin, plasminogen activator inhibitor type 1), member 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MNWHLPLFLLASVTLPSICSHFNPLSLEELGSNTGIQVFNQIVKSRPHDNIVISPHGIASVLGMLQLGADGRTKKQLAMVMRYGVNGVGKILKKINKAIVSKKNKDIVTVANAVFVKNASEIEVPFVTRNKDVFQCEVRNVNFEDPASACDSINAWVKNETRDMIDNLLSPDLIDGVLTRLVLVNAVYFKGLWKSRFQPENTKKRTFVAADGKSYQVPMLAQLSVFRCGSTSAPNDLWYNFIELPYHGESISMLI
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINE2 (NP_006207.1, 1 a.a. ~ 398 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5270

Enviar un mensaje


SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)

SERPINE2 purified MaxPab mouse polyclonal antibody (B01P)