SERPINA1 MaxPab mouse polyclonal antibody (B01P)
  • SERPINA1 MaxPab mouse polyclonal antibody (B01P)

SERPINA1 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005265-B01P
SERPINA1 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SERPINA1 protein.
Información adicional
Size 50 ug
Gene Name SERPINA1
Gene Alias A1A|A1AT|AAT|MGC23330|MGC9222|PI|PI1|PRO2275
Gene Description serpin peptidase inhibitor, clade A (alpha-1 antiproteinase, antitrypsin), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MPSSVSWGILLLAGLCCLVPVSLAEDPQGDAAQKTDTSHHDQDHPTFNKITPNLAEFAFSLYRQLAHQSNSTNIFFSPVSIATAFAMLSLGTKADTHDEILEGLNFNLTEIPEAQIHEGFQELLRTLNQPDSQLQLTTGNGLFLSEGLKLVDKFLEDVKKLYHSEAFTVNFGDTEEAKKQINDYVEKGTQGKIVDLVKELDRDTVFALVNYIFFKGKWERPFEVKDTEEEDFHVDQATTVKVPMMKRLGMFNIQH
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINA1 (AAH15642.1, 1 a.a. ~ 418 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5265

Enviar un mensaje


SERPINA1 MaxPab mouse polyclonal antibody (B01P)

SERPINA1 MaxPab mouse polyclonal antibody (B01P)