PHKB monoclonal antibody (M02), clone 2E9
  • PHKB monoclonal antibody (M02), clone 2E9

PHKB monoclonal antibody (M02), clone 2E9

Ref: AB-H00005257-M02
PHKB monoclonal antibody (M02), clone 2E9

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHKB.
Información adicional
Size 100 ug
Gene Name PHKB
Gene Alias DKFZp781E15103|FLJ41698
Gene Description phosphorylase kinase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHKB (NP_000284, 984 a.a. ~ 1093 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5257
Clone Number 2E9
Iso type IgG2a Kappa

Enviar un mensaje


PHKB monoclonal antibody (M02), clone 2E9

PHKB monoclonal antibody (M02), clone 2E9