PHKB polyclonal antibody (A01)
  • PHKB polyclonal antibody (A01)

PHKB polyclonal antibody (A01)

Ref: AB-H00005257-A01
PHKB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PHKB.
Información adicional
Size 50 uL
Gene Name PHKB
Gene Alias DKFZp781E15103|FLJ41698
Gene Description phosphorylase kinase, beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq EDTLGNIDQPQYRQIVVELLMVVSIVLERNPELEFQDKVDLDRLVKEAFNEFQKDQSRLKEIEKQDDMTSFYNTPPLGKRGTCSYLTKAVMNLLLEGEVKPNNDDPCLIS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHKB (NP_000284, 984 a.a. ~ 1093 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5257

Enviar un mensaje


PHKB polyclonal antibody (A01)

PHKB polyclonal antibody (A01)