PHKA1 polyclonal antibody (A01)
  • PHKA1 polyclonal antibody (A01)

PHKA1 polyclonal antibody (A01)

Ref: AB-H00005255-A01
PHKA1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PHKA1.
Información adicional
Size 50 uL
Gene Name PHKA1
Gene Alias MGC132604|PHKA
Gene Description phosphorylase kinase, alpha 1 (muscle)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq DYDDNYDYLESGNWMNDYDSTSHARCGDEVARYLDHLLAHTAPHPKLAPTSQKGGLDRFQAAVQTTCDLMSLVTKAKELHVQNVHMYLPTKLFQASRPSF
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHKA1 (NP_002628, 631 a.a. ~ 730 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5255

Enviar un mensaje


PHKA1 polyclonal antibody (A01)

PHKA1 polyclonal antibody (A01)