PHF2 monoclonal antibody (M02A), clone 3E7
  • PHF2 monoclonal antibody (M02A), clone 3E7

PHF2 monoclonal antibody (M02A), clone 3E7

Ref: AB-H00005253-M02A
PHF2 monoclonal antibody (M02A), clone 3E7

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHF2.
Información adicional
Size 200 uL
Gene Name PHF2
Gene Alias GRC5|JHDM1E|KIAA0662|MGC176680
Gene Description PHD finger protein 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ATVPVYCVCRLPYDVTRFMIECDACKDWFHGSCVGVEEEEAPDIDIYHCPNCEKTHGKSTLKKKRTWHKHGPGQAPDVKPVQNGSQLFIKELRSRTFPS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF2 (NP_005383, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In ascites fluid
Gene ID 5253
Clone Number 3E7
Iso type IgM Kappa

Enviar un mensaje


PHF2 monoclonal antibody (M02A), clone 3E7

PHF2 monoclonal antibody (M02A), clone 3E7