PHF1 monoclonal antibody (M05), clone 4F5
  • PHF1 monoclonal antibody (M05), clone 4F5

PHF1 monoclonal antibody (M05), clone 4F5

Ref: AB-H00005252-M05
PHF1 monoclonal antibody (M05), clone 4F5

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PHF1.
Información adicional
Size 100 ug
Gene Name PHF1
Gene Alias MTF2L2|PCL1|PHF2
Gene Description PHD finger protein 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5252
Clone Number 4F5
Iso type IgG2a Kappa

Enviar un mensaje


PHF1 monoclonal antibody (M05), clone 4F5

PHF1 monoclonal antibody (M05), clone 4F5