PHF1 monoclonal antibody (M03), clone 2A12 Ver mas grande

PHF1 monoclonal antibody (M03), clone 2A12

AB-H00005252-M03

Producto nuevo

PHF1 monoclonal antibody (M03), clone 2A12

Más detalles

Por favor regístrese para ver el precio

Comprando este producto generará 3 Biopuntos. Su cesta contiene un total 3 Biopuntos puede ser convertido en un Biobonos Descuento 12.00EUR.


Hoja técnica

Size 100 ug
Gene Name PHF1
Gene Alias MTF2L2|PCL1|PHF2
Gene Description PHD finger protein 1
Storage Conditions Store at -20ºC or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq AQPPRLSRSGASSLWDPASPAPTSGPRPRLWEGQDVLARWTDGLLYLGTIKKVDSAREVCLVQFEDDSQFLVLWKDISPAALPGEELLCCVCRSETVVP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PHF1 (NP_077084, 2 a.a. ~ 100 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5252
Clone Number 2A12
Iso type IgG1 Kappa

Más información

Mouse monoclonal antibody raised against a partial recombinant PHF1.

Consulta sobre un producto

PHF1 monoclonal antibody (M03), clone 2A12

PHF1 monoclonal antibody (M03), clone 2A12