SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)
  • SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)

SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)

Ref: AB-H00005250-B02P
SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)

Información del producto

Mouse polyclonal antibody raised against a full-length human SLC25A3 protein.
Información adicional
Size 50 ug
Gene Name SLC25A3
Gene Alias OK/SW-cl.48|PHC
Gene Description solute carrier family 25 (mitochondrial carrier
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr,IF
Immunogen Prot. Seq MFSSVAHLARANPFNTPHLQLVHDGLGDLRSSSPGPTGQPRRPRNLAAAAVEEYSCEFGSAKYYALCGFGGVLSCGLTHTAVVPLDLVKCRMQVDPQKYKGIFNGFSVTLKEDGVRGLAKGWAPTFLGYSMQGLCKFGFYEVFKVLYSNMLGEENTYLWRTSLYLAASASAEFFADIALAPMEAAKVRIQTQPGYANTLRDAAPKMYKEEGLKAFYKGVAPLWMRQIPYTMMKFACFERTVEALYKFVVPKPRSE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SLC25A3 (NP_002626.1, 1 a.a. ~ 361 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5250

Enviar un mensaje


SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)

SLC25A3 purified MaxPab mouse polyclonal antibody (B02P)