PGR monoclonal antibody (M05), clone 1B11
  • PGR monoclonal antibody (M05), clone 1B11

PGR monoclonal antibody (M05), clone 1B11

Ref: AB-H00005241-M05
PGR monoclonal antibody (M05), clone 1B11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PGR. This PGR gene uses two distinct promoters and translation start sites in the first exon to produce two isoforms, A and B. The two isoforms are identical except for the additional 165 amino acids found in the N-terminus of isoform B. Our immunogen corresponds to the specific region of isoform B, thus this antibody is a PGR isofrom B specific antibody.
Información adicional
Size 100 ug
Gene Name PGR
Gene Alias NR3C3|PR
Gene Description progesterone receptor
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,IHC-P,S-ELISA,ELISA,IF
Immunogen Prot. Seq MTELKAKGPRAPHVAGGPPSPEVGSPLLCRPAAGPFPGSQTSDTLPEVSAIPISLDGLLFPRPCQGQDPSDEKTQDQQSLSDVEGAYSRAEATRGAGGSSSSPPEKDSGL
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGR (NP_000917, 1 a.a. ~ 110 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5241
Clone Number 1B11
Iso type IgG1 Kappa

Enviar un mensaje


PGR monoclonal antibody (M05), clone 1B11

PGR monoclonal antibody (M05), clone 1B11