PGM1 polyclonal antibody (A01)
  • PGM1 polyclonal antibody (A01)

PGM1 polyclonal antibody (A01)

Ref: AB-H00005236-A01
PGM1 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PGM1.
Información adicional
Size 50 uL
Gene Name PGM1
Gene Alias -
Gene Description phosphoglucomutase 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq MVKIVTVKTQAYQDQKPGTSGLRKRVKVFQSSANYAENFIQSIISTVEPAQRQEATLVVGGDGRFYMKEAIQLIARIAAANGIGRLVIGQNGILSTPAVSCIIRKIKAIGGIILTASHNPGGPNGDFGIKFNISNGGPAPEAITDKIFQISKTIEEYAVCPDLKVDLGVLGKQQFDLENKFKPFTVEIVDSVEAYATMLRSIFDFSALKELLSGPNRLKIRIDAMHGVVGPYVKKILCEELGAPANSAVNCVPLE
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGM1 (AAH19920, 1 a.a. ~ 562 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5236

Enviar un mensaje


PGM1 polyclonal antibody (A01)

PGM1 polyclonal antibody (A01)