PGK2 polyclonal antibody (A01)
  • PGK2 polyclonal antibody (A01)

PGK2 polyclonal antibody (A01)

Ref: AB-H00005232-A01
PGK2 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PGK2.
Información adicional
Size 50 uL
Gene Name PGK2
Gene Alias PGK-2|PGKB|PGKPS|dJ417L20.2
Gene Description phosphoglycerate kinase 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq DIMAKAQKNGVRITFPVDFVTGDKFDENAQVGKATVASGISPGWMGLDCGPESNKNHAQVVAQARLIVWNGP
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PGK2 (NP_620061, 268 a.a. ~ 339 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5232

Enviar un mensaje


PGK2 polyclonal antibody (A01)

PGK2 polyclonal antibody (A01)