PGC purified MaxPab rabbit polyclonal antibody (D01P)
  • PGC purified MaxPab rabbit polyclonal antibody (D01P)

PGC purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005225-D01P
PGC purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PGC protein.
Información adicional
Size 100 ug
Gene Name PGC
Gene Alias -
Gene Description progastricsin (pepsinogen C)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MKWMVVVLVCLQLLEAAVVKVPLKKFKSIRETMKEKGLLGEFLRTHKYDPAWKYRFGDLSVTYEPMAYMDAAYFGEISIGTPPQNFLVLFDTGSSNLWVPSVYCQSQACTSHSRFNPSESSTYSTNGQTFSLQYGSGSLTGFFGYDTLTVQSIQVPNQEFGLSENEPGTNFVYAQFDGIMGLAYPALSVDEATTAMQGMVQEGALTSPVFSVYLSNQQGSSGGAVVFGGVDSSLYTGQIYWAPVTQELYWQIGIE
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PGC (NP_002621.1, 1 a.a. ~ 388 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5225

Enviar un mensaje


PGC purified MaxPab rabbit polyclonal antibody (D01P)

PGC purified MaxPab rabbit polyclonal antibody (D01P)