PFN2 purified MaxPab rabbit polyclonal antibody (D01P)
  • PFN2 purified MaxPab rabbit polyclonal antibody (D01P)

PFN2 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005217-D01P
PFN2 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFN2 protein.
Información adicional
Size 100 ug
Gene Name PFN2
Gene Alias D3S1319E|PFL
Gene Description profilin 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGWQSYVDNLMCDGCCQEAAIVGYCDAKYVWAATAGGVFQSITPIEIDMIVGKDREGFFTNGLALGAKKCSVIRDSLYVDGDCTMDIRTKSQGGEPTYNVAVGRAGRVLVFVMGKEGVHGGGLNKKAYSMAKYLRDSGF
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFN2 (AAH18049.1, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5217

Enviar un mensaje


PFN2 purified MaxPab rabbit polyclonal antibody (D01P)

PFN2 purified MaxPab rabbit polyclonal antibody (D01P)