PFN1 purified MaxPab mouse polyclonal antibody (B01P)
  • PFN1 purified MaxPab mouse polyclonal antibody (B01P)

PFN1 purified MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005216-B01P
PFN1 purified MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PFN1 protein.
Información adicional
Size 50 ug
Gene Name PFN1
Gene Alias -
Gene Description profilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFN1 (AAH06768, 1 a.a. ~ 140 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5216

Enviar un mensaje


PFN1 purified MaxPab mouse polyclonal antibody (B01P)

PFN1 purified MaxPab mouse polyclonal antibody (B01P)