PFN1 polyclonal antibody (A02)
  • PFN1 polyclonal antibody (A02)

PFN1 polyclonal antibody (A02)

Ref: AB-H00005216-A02
PFN1 polyclonal antibody (A02)

Información del producto

Mouse polyclonal antibody raised against a full-length recombinant PFN1.
Información adicional
Size 50 uL
Gene Name PFN1
Gene Alias -
Gene Description profilin 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq MAGWNAYIDNLMADGTCQDAAIVGYKDSPSVWAAVPGKTFVNITPAEVGVLVGKDRSSFYVNGLTLGGQKCSVIRDSLLQDGEFSMDLRTKSTGGAPTFNVTVTKTDKTLVLLMGKEGVHGGLINKKCYEMASHLRRSQY
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PFN1 (AAH15164, 1 a.a. ~ 140 a.a) full-length recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5216

Enviar un mensaje


PFN1 polyclonal antibody (A02)

PFN1 polyclonal antibody (A02)