PFKP MaxPab rabbit polyclonal antibody (D01)
  • PFKP MaxPab rabbit polyclonal antibody (D01)

PFKP MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005214-D01
PFKP MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFKP protein.
Información adicional
Size 100 uL
Gene Name PFKP
Gene Alias FLJ40226|PFK-C|PFKF
Gene Description phosphofructokinase, platelet
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Tr,IP
Immunogen Prot. Seq MDADDSRAPKGSLRKFLEHLSGAGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVGAKVYFIYEGYQGMVDGGSNIAEADWESVSSILQVGGTIIGSARCQAFRTREGRLKAACNLLQRGITNLCVIGGDGSLTGANLFRKEWSGLLEELARNGQIDKEAVQKYAYLNVVGMVGSIDNDFCGTDMTIGTDSALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFLPESPPEEGWEEQMCVK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKP (NP_002618.1, 1 a.a. ~ 784 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5214

Enviar un mensaje


PFKP MaxPab rabbit polyclonal antibody (D01)

PFKP MaxPab rabbit polyclonal antibody (D01)