PFKM MaxPab rabbit polyclonal antibody (D01)
  • PFKM MaxPab rabbit polyclonal antibody (D01)

PFKM MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005213-D01
PFKM MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PFKM protein.
Información adicional
Size 100 uL
Gene Name PFKM
Gene Alias GSD7|MGC8699|PFK-1|PFK-M|PFKX
Gene Description phosphofructokinase, muscle
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MTHEEHHAAKTLGIGKAIAVLTSGGDAQGMNAAVRAVVRVGIFTGARVFFVHEGYQGLVDGGDHIKEATWESVSMMLQLGGTVIGSARCKDFREREGRLRAAYNLVKRGITNLCVIGGDGSLTGADTFRSEWSDLLSDLQKAGKITDEEATKSSYLNIVGLVGSIDNDFCGTDMTIGTDSALHRIMEIVDAITTTAQSHQRTFVLEVMGRHCGYLALVTSLSCGADWVFIPECPPDDDWEEHLCRRLSETRTRGS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFKM (NP_000280.1, 1 a.a. ~ 780 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5213

Enviar un mensaje


PFKM MaxPab rabbit polyclonal antibody (D01)

PFKM MaxPab rabbit polyclonal antibody (D01)