PFDN5 polyclonal antibody (A01)
  • PFDN5 polyclonal antibody (A01)

PFDN5 polyclonal antibody (A01)

Ref: AB-H00005204-A01
PFDN5 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PFDN5.
Información adicional
Size 50 uL
Gene Name PFDN5
Gene Alias MGC5329|MGC71907|MM-1|MM1|PFD5
Gene Description prefoldin subunit 5
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,ELISA
Immunogen Prot. Seq QTKYVEAKDCLNVLNKSNEGKELLVPLTSSMYVPGKLHDVEHVLIDVGTGYYVEKTAEDAKDFFKRKIDFLTKQMEKIQPALQEKHAMKQAVMEMMSQKI
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PFDN5 (NP_002615, 40 a.a. ~ 139 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5204

Enviar un mensaje


PFDN5 polyclonal antibody (A01)

PFDN5 polyclonal antibody (A01)