PFDN2 MaxPab mouse polyclonal antibody (B01P)
  • PFDN2 MaxPab mouse polyclonal antibody (B01P)

PFDN2 MaxPab mouse polyclonal antibody (B01P)

Ref: AB-H00005202-B01P
PFDN2 MaxPab mouse polyclonal antibody (B01P)

Información del producto

Mouse polyclonal antibody raised against a full-length human PFDN2 protein.
Información adicional
Size 50 ug
Gene Name PFDN2
Gene Alias PFD2
Gene Description prefoldin subunit 2
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAENSGRAGKSSGSGAGKGAVSAEQVIAGFNRLRQEQRGLASKAAELEMELNEHSLVIDTLKEVDETRKCYRMVGGVLVERTVKEVLPALENNKEQIQKIIETLTQQLQAKGKELNEFREKHNIRLMGEDEKPAAKENSEGAGAKASSAGVLVS
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PFDN2 (NP_036526, 1 a.a. ~ 154 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5202

Enviar un mensaje


PFDN2 MaxPab mouse polyclonal antibody (B01P)

PFDN2 MaxPab mouse polyclonal antibody (B01P)