PF4 purified MaxPab rabbit polyclonal antibody (D01P)
  • PF4 purified MaxPab rabbit polyclonal antibody (D01P)

PF4 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005196-D01P
PF4 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PF4 protein.
Información adicional
Size 100 ug
Gene Name PF4
Gene Alias CXCL4|MGC138298|SCYB4
Gene Description platelet factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Ce,WB-Tr
Immunogen Prot. Seq MSSAAGFCASRPGLLFLGLLLLPLVVAFASAEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PF4 (NP_002610.1, 1 a.a. ~ 101 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5196

Enviar un mensaje


PF4 purified MaxPab rabbit polyclonal antibody (D01P)

PF4 purified MaxPab rabbit polyclonal antibody (D01P)