PF4 polyclonal antibody (A01)
  • PF4 polyclonal antibody (A01)

PF4 polyclonal antibody (A01)

Ref: AB-H00005196-A01
PF4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PF4.
Información adicional
Size 50 uL
Gene Name PF4
Gene Alias CXCL4|MGC138298|SCYB4
Gene Description platelet factor 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq AEAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PF4 (NP_002610, 31 a.a. ~ 101 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5196

Enviar un mensaje


PF4 polyclonal antibody (A01)

PF4 polyclonal antibody (A01)