PEX10 MaxPab rabbit polyclonal antibody (D01)
  • PEX10 MaxPab rabbit polyclonal antibody (D01)

PEX10 MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005192-D01
PEX10 MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PEX10 protein.
Información adicional
Size 100 uL
Gene Name PEX10
Gene Alias MGC1998|NALD|RNF69
Gene Description peroxisomal biogenesis factor 10
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key IP
Immunogen Prot. Seq MAPAAASPPEVIRAAQKDEYYRGGLRSAAGGALHSLAGARKWLEWRKEVELLSDVAYFGLTTLAGYQTLGEEYVSIIQVDPSRIHVPSSLRRGVLVTLHAVLPYLLDKALLPLEQELQADPDSGRPLQGSLGPGGRGCSGARRWMRHHTATLTEQQRRALLRAVFVLRQGLACLQRLHVAWFYIHGVFYHLAKRLTGITYQALRPDPLRVLMSVAPSALQLRVRSLPGEDLRARVSYRLLGVISLLHLVLSMGLQ
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PEX10 (NP_722540.1, 1 a.a. ~ 346 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5192

Enviar un mensaje


PEX10 MaxPab rabbit polyclonal antibody (D01)

PEX10 MaxPab rabbit polyclonal antibody (D01)