PET112L monoclonal antibody (M01), clone 6B2
  • PET112L monoclonal antibody (M01), clone 6B2

PET112L monoclonal antibody (M01), clone 6B2

Ref: AB-H00005188-M01
PET112L monoclonal antibody (M01), clone 6B2

Información del producto

Mouse monoclonal antibody raised against a partial recombinant PET112L.
Información adicional
Size 100 ug
Gene Name PET112L
Gene Alias HSPC199|PET112
Gene Description PET112-like (yeast)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ce,WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq SAAKQVFEELWKREGKTPGQIVSEKQLELMQDQGALEQLCHSVMEAHPQVVMDVKNRNPRAINKLIGLVRKATQSRADPVMIKEILEKKLS
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PET112L (NP_004555, 466 a.a. ~ 556 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5188
Clone Number 6B2
Iso type IgG2a Kappa

Enviar un mensaje


PET112L monoclonal antibody (M01), clone 6B2

PET112L monoclonal antibody (M01), clone 6B2