SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)
  • SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005176-D01P
SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human SERPINF1 protein.
Información adicional
Size 100 ug
Gene Name SERPINF1
Gene Alias EPC-1|PEDF|PIG35
Gene Description serpin peptidase inhibitor, clade F (alpha-2 antiplasmin, pigment epithelium derived factor), member 1
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MQALVLLLCIGALLGHSSCQNPASPPEEGSPDPDSTGALVEEEDPFFKVPVNKLAAAVSNFGYDLYRVRSSTSPTTNVLLSPLSVATALSALSLGAEQRTESIIHRALYYDLISSPDIHGTYKELLDTVTAPQKNLKSASRIVFEKKLRIKSSFVAPLEKSYGTRPRVLTGNPRLDLQEINNWVQAQMKGKLARSTKEIPDEISILLLGVAHFKGQWVTKFDSRKTSLEDFYLDEERTVRVPMMSDPKAVLRYGL
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen SERPINF1 (NP_002606.3, 1 a.a. ~ 418 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5176

Enviar un mensaje


SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)

SERPINF1 purified MaxPab rabbit polyclonal antibody (D01P)