PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)
  • PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)

PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005175-D01P
PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PECAM1 protein.
Información adicional
Size 100 ug
Gene Name PECAM1
Gene Alias CD31|PECAM-1
Gene Description platelet/endothelial cell adhesion molecule
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,PLA-Ce
Immunogen Prot. Seq MQPRWAQGATMWLGVLLTLLLCSSLEGQENSFTINSVDMKSLPDWTVQNGKNLTLQCFADVSTTSHVKPQHQMLFYKDDVLFYNISSMKSTESYFIPEVRIYDSGTYKCTVIVNNKEKTTAEYQVLVEGVPSPRVTLDKKEAIQGGIVRVNCSVPEEKAPIHFTIEKLELNEKMVKLKREKNSRDQNFVILEFPVEEQDRVLSFRCQARIISGIHMQTSESTKSELVTVTESFSTPKFHISPTGMIMEGAQLHIK
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PECAM1 (AAH51822.1, 1 a.a. ~ 738 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5175

Enviar un mensaje


PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)

PECAM1 purified MaxPab rabbit polyclonal antibody (D01P)