ENPP3 monoclonal antibody (M01), clone 1G11
  • ENPP3 monoclonal antibody (M01), clone 1G11

ENPP3 monoclonal antibody (M01), clone 1G11

Ref: AB-H00005169-M01
ENPP3 monoclonal antibody (M01), clone 1G11

Información del producto

Mouse monoclonal antibody raised against a partial recombinant ENPP3.
Información adicional
Size 100 ug
Gene Name ENPP3
Gene Alias B10|CD203c|NPP3|PD-IBETA|PDNP3
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,S-ELISA,ELISA
Immunogen Prot. Seq ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENPP3 (NP_005012, 602 a.a. ~ 699 a.a) partial recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5169
Clone Number 1G11
Iso type IgG2a Kappa

Enviar un mensaje


ENPP3 monoclonal antibody (M01), clone 1G11

ENPP3 monoclonal antibody (M01), clone 1G11