ENPP3 polyclonal antibody (A01)
  • ENPP3 polyclonal antibody (A01)

ENPP3 polyclonal antibody (A01)

Ref: AB-H00005169-A01
ENPP3 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant ENPP3.
Información adicional
Size 50 uL
Gene Name ENPP3
Gene Alias B10|CD203c|NPP3|PD-IBETA|PDNP3
Gene Description ectonucleotide pyrophosphatase/phosphodiesterase 3
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq ATVKVNLPFGRPRVLQKNVDHCLLYHREYVSGFGKAMRMPMWSSYTVPQLGDTSPLPPTVPDCLRADVRVPPSESQKCSFYLADKNITHGFLYPPASN
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen ENPP3 (NP_005012, 602 a.a. ~ 699 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5169

Enviar un mensaje


ENPP3 polyclonal antibody (A01)

ENPP3 polyclonal antibody (A01)