PDK4 polyclonal antibody (A01)
  • PDK4 polyclonal antibody (A01)

PDK4 polyclonal antibody (A01)

Ref: AB-H00005166-A01
PDK4 polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDK4.
Información adicional
Size 50 uL
Gene Name PDK4
Gene Alias FLJ40832
Gene Description pyruvate dehydrogenase kinase, isozyme 4
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SDSQTGNPSHIGSIDPNCDVVAVVQDAFGCSRMLCDQYYLSSPELKLTQANGKFPDQPIHIVYVPSHLHHMLFELFKNAMRATVEHQENQPSLTPIEVIV
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDK4 (AAH40239, 181 a.a. ~ 280 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5166

Enviar un mensaje


PDK4 polyclonal antibody (A01)

PDK4 polyclonal antibody (A01)