PDHB purified MaxPab rabbit polyclonal antibody (D01P)
  • PDHB purified MaxPab rabbit polyclonal antibody (D01P)

PDHB purified MaxPab rabbit polyclonal antibody (D01P)

Ref: AB-H00005162-D01P
PDHB purified MaxPab rabbit polyclonal antibody (D01P)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDHB protein.
Información adicional
Size 100 ug
Gene Name PDHB
Gene Alias DKFZp564K0164|PHE1B
Gene Description pyruvate dehydrogenase (lipoamide) beta
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Tr
Immunogen Prot. Seq MAAVSGLVRRPLREVSGLLKRRFHWTAPAALQVTVRDAINQGMDEELERDEKVFLLGEEVAQYDGAYKVSRGLWKKYGDKRIIDTPISEMGFAGIAVGAAMAGLRPICEFMTFNFSMQAIDQVINSAAKTYYMSGGLQPVPIVFRGPNGASAGVAAQHSQCFAAWYGHCPGLKVVSPWNSEDAKGLIKSAIRDNNPVVVLENELMYGVPFEFPPEAQSKDFLIPIGKAKIERQGTHITVVSHSRPVGHCLEAAAV
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDHB (AAH01924.1, 1 a.a. ~ 359 a.a) full-length human protein.
Storage Buffer In 1x PBS, pH 7.4
Gene ID 5162

Enviar un mensaje


PDHB purified MaxPab rabbit polyclonal antibody (D01P)

PDHB purified MaxPab rabbit polyclonal antibody (D01P)