PDGFRB MaxPab rabbit polyclonal antibody (D01)
  • PDGFRB MaxPab rabbit polyclonal antibody (D01)

PDGFRB MaxPab rabbit polyclonal antibody (D01)

Ref: AB-H00005159-D01
PDGFRB MaxPab rabbit polyclonal antibody (D01)

Información del producto

Rabbit polyclonal antibody raised against a full-length human PDGFRB protein.
Información adicional
Size 100 uL
Gene Name PDGFRB
Gene Alias CD140B|JTK12|PDGF-R-beta|PDGFR|PDGFR1
Gene Description platelet-derived growth factor receptor, beta polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Ti,WB-Tr,IP
Immunogen Prot. Seq MRLPGAMPALALKGELLLLSLLLLLEPQISQGLVVTPPGPELVLNVSSTFVLTCSGSAPVVWERMSQEPPQEMAKAQDGTFSSVLTLTNLTGLDTGEYFCTHNDSRGLETDERKRLYIFVPDPTVGFLPNDAEELFIFLTEITEITIPCRVTDPQLVVTLHEKKGDVALPVPYDHQRGFFGIFEDRSYICKTTIGDREVDSDAYYVYRLQVSSINVSVNAVQTVVRQGENITLMCIVIGNEVVNFEWTYPRKESG
Antigen species Target species Human
Quality control testing Antibody reactive against mammalian transfected lysate.
Immunogen PDGFRB (AAH32224.1, 1 a.a. ~ 1106 a.a) full-length human protein.
Storage Buffer No additive
Gene ID 5159

Enviar un mensaje


PDGFRB MaxPab rabbit polyclonal antibody (D01)

PDGFRB MaxPab rabbit polyclonal antibody (D01)