PDGFB polyclonal antibody (A01)
  • PDGFB polyclonal antibody (A01)

PDGFB polyclonal antibody (A01)

Ref: AB-H00005155-A01
PDGFB polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDGFB.
Información adicional
Size 50 uL
Gene Name PDGFB
Gene Alias FLJ12858|PDGF2|SIS|SSV|c-sis
Gene Description platelet-derived growth factor beta polypeptide (simian sarcoma viral (v-sis) oncogene homolog)
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq SLGSLTIAEPAMIAECKTRTEVFEISRRLIDRTNANFLVWPPCVEVQRCSGCCNNRNVQCRPTQVQLRPVQVRKIEIVRKKPIFKKATVTLEDHLACKCETVAAARPVT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDGFB (NP_002599, 82 a.a. ~ 190 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5155

Enviar un mensaje


PDGFB polyclonal antibody (A01)

PDGFB polyclonal antibody (A01)