PDGFA polyclonal antibody (A01)
  • PDGFA polyclonal antibody (A01)

PDGFA polyclonal antibody (A01)

Ref: AB-H00005154-A01
PDGFA polyclonal antibody (A01)

Información del producto

Mouse polyclonal antibody raised against a partial recombinant PDGFA.
Información adicional
Size 50 uL
Gene Name PDGFA
Gene Alias PDGF-A|PDGF1
Gene Description platelet-derived growth factor alpha polypeptide
Storage Conditions Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
Application Key WB-Re,ELISA
Immunogen Prot. Seq RKRSIEEAVPAVCKTRTVIYEIPRSQVDPTSANFLIWPPCVEVKRCTGCCNTSSVKCQPSRVHHRSVKVAKVEYVRKKPKLKEVQVRLEEHLECACATTSLNPDYREEDT
Antigen species Target species Human
Quality control testing Antibody Reactive Against Recombinant Protein.
Immunogen PDGFA (NP_715639, 84 a.a. ~ 193 a.a) partial recombinant protein with GST tag.
Storage Buffer 50 % glycerol
Gene ID 5154

Enviar un mensaje


PDGFA polyclonal antibody (A01)

PDGFA polyclonal antibody (A01)